peptide sequencing의 방법으로 N-terminus 일부와 C-terminus 일부 아미노산 배열이 밝혀진 단백질 X의 특성 밝히기
*무*
다운로드
장바구니
소개글
미생물학과 재조합단백질공학 기말레포트입니다.저희학교 이 교수님 수업을 듣는다면 아주 유용하겠죠~`
목차
1. Internet에서 유전자를 검색할 수 있는 프로그램을 이용하여 peptide sequencing의 방법으로 N-terminus 일부와 C-terminus 일부 아미노산 배열 (N-MFTWRCLILWAVLVTATLSAARPAPTLPDQALPKANIEVESHSAHPGDLLVFSHDPLPDEPCLPRCPPHSHGALKRH-C)이 밝혀진 단백질 X의 특성을 밝히려한다.2. 1) E. coli strain 중에서 BMH71-18, JM109, DH5a, BL21(DE), DH10B의 genotype 을 결정하고 각각의 genotype을 설명하라.
3. 1) Internet을 이용하여 E. coli의 β-galactosidase유전자를 검색하여라
4. The figure at the bottom shows the results of an experiment you perform to determine the location of a promoter. The horizontal line indicates a gene, whose transcript starts at position 1. A series of constructs containinf different deletions are created using genetic engineering techniques. The blank (missing) segments of the line indicate the missing segnemts of the DNA (for example, construct `b` is missing nucleotides from -400 to -200). You put each of these DNAs into a cell and determine if transcription occurs from this gene. What is the range of positions that contains the promoter for this gene? Explain your answer.
5. 항원 X에 특이적인 lgG 생쥐항체의 molecular weight는 약 160 kDa이며 화학적 또는 효소를 이용하여 단편으로 절단되기도 한다. 화학적 (panel a) 도는 효소를 이용하여 (panel b) 절단된 항체단백질단편(fragment)의 gel filtration pattern을 아래 figure에서 보여주고 있다. peak Ⅲ는 항원 X에 결합하나 peak Ⅰ,Ⅱ and Ⅳ는 결합하지 않음이 관찰되었다. 또 peak Ⅳ만이 effector function을 나타내었다.
6. 전 세계적으로 pET vector를 단백질 발현 vector로 가장 많이 사용하고 있다. pET vector를 이용한 단백질 발현 system에 대해 internet을 검색하여 구체적으로 설명하여라.
7. 신종플루가 전세계적으로 확산되고 있다
본문내용
1. Internet에서 유전자를 검색할 수 있는 프로그램을 이용하여 peptide sequencing의 방법으로 N-terminus 일부와 C-terminus 일부 아미노산 배열 (N-MFTWRCLILWAVLVTATLSAARPAPTLPDQALPKANIEVESHSAHPGDLL.......VFSHDPLPDEPCLPRCPPHSHGALKRH-C)이 밝혀진 단백질 X의 특성을 밝히려한다.1) 단백질 X를 Internet을 통해 검색하여 단백질 X의 유전자 및 단백질의
full sequences를 밝히고 그 기능을 조사하여라. (검색과정을 제시할 것.)
미국국립생물정보센터(http://www.ncbi.nlm.nih.gov)에 접속 → Blast를 클릭 → protein blast클릭 → 위의 아미노산배열을 검색 → 검색결과로 많은 것이 나오는데 그중 가장 상동성이 높은 것이 NP_990841 → 이걸 클릭하면 특징 및 정의등이 나옴 (정의: fibroblast growth facter recepter 1, 닭의 조직에서 얻어진 단백질)
유전자 서열을 알기위해서는 gene name인 FGFR1으로 검색 → NM_205510 (이것이 NP_990841단백질을 발현하는 유전자)
LOCUS NP_990841 819 aa linear VRT 13-APR-2008
DEFINITION fibroblast growth factor receptor 1 [Gallus gallus].
ACCESSION NP_990841
VERSION NP_990841.1 GI:45382885
DBSOURCE REFSEQ: accession NM_205510.1
KEYWORDS .
SOURCE Gallus gallus (chicken)
ORGANISM Gallus gallus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria;
Aves; Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus.
FEATURES Location/Qualifiers
source 1..819
/organism="Gallus gallus"
/db_xref="taxon:9031"
/chromosome="22"
/map="22"
Protein 1..819
/product="fibroblast growth factor receptor 1"
/note="cek1 protein"
sig_peptide 1..22
/note="cek1 protein signal peptide"
/calculated_mol_wt=2523
mat_peptide 22..819